(data stored in ACNUC7421 zone)

EMBL: CP002047.PE537

CP002047.PE537       Location/Qualifiers
FT   CDS             complement(633848..634063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00537"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03658"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0G7"
FT                   /protein_id="ADI03658.1"
FT                   /translation="MVEWAHGCAGRTVTWPAPDAYVLVDGVLLRMVPEPPGLPPGTAVT
FT                   VRHDPERQRLVAHADGTADSTGAAAV"
     MVEWAHGCAG RTVTWPAPDA YVLVDGVLLR MVPEPPGLPP GTAVTVRHDP ERQRLVAHAD        60
     GTADSTGAAA V                                                             71
//

If you have problems or comments...

PBIL Back to PBIL home page