(data stored in ACNUC7421 zone)

EMBL: CP002047.PE538

CP002047.PE538       Location/Qualifiers
FT   CDS             complement(634221..635291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00538"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03659"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0G8"
FT                   /protein_id="ADI03659.1"
FT                   /translation="MQEVRRAGLLRLRGRELPALESAAASSATARTREGAVEALLRHAV
FT                   ERLDAGTLRTAAEYTLGLAQGTRDWPASSRRARAAEVYRVSEERFRKHHEVMVLGQVAE
FT                   HIVELVELTRGGDDEPGEGDWEGDTHRFVDVLAGDRTVRLTLHIHPVDLLRDVDVVVSP
FT                   ANTYFALPEPYKSSVSASLRRAASVRGVTGDLLDDPVHEELRIWAARQGTSGRPVVPGT
FT                   VAATGSGAMAEYGVRRIYHAAVAVPRAGTNDYDVLPADVTRATSRAIALLAEERDRHTP
FT                   PLRSVCFPLLGSGRGGLPYRVSAAAVWSAVEAELARGARWDVHFVVRTPEAARVVERIP
FT                   ARTRPGRDQSAPGRSV"
     MQEVRRAGLL RLRGRELPAL ESAAASSATA RTREGAVEAL LRHAVERLDA GTLRTAAEYT        60
     LGLAQGTRDW PASSRRARAA EVYRVSEERF RKHHEVMVLG QVAEHIVELV ELTRGGDDEP       120
     GEGDWEGDTH RFVDVLAGDR TVRLTLHIHP VDLLRDVDVV VSPANTYFAL PEPYKSSVSA       180
     SLRRAASVRG VTGDLLDDPV HEELRIWAAR QGTSGRPVVP GTVAATGSGA MAEYGVRRIY       240
     HAAVAVPRAG TNDYDVLPAD VTRATSRAIA LLAEERDRHT PPLRSVCFPL LGSGRGGLPY       300
     RVSAAAVWSA VEAELARGAR WDVHFVVRTP EAARVVERIP ARTRPGRDQS APGRSV           356
//

If you have problems or comments...

PBIL Back to PBIL home page