(data stored in ACNUC7421 zone)

EMBL: CP002047.PE539

CP002047.PE539       Location/Qualifiers
FT   CDS             complement(635408..636085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00539"
FT                   /product="RES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00539"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03660"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0G9"
FT                   /protein_id="ADI03660.1"
FT                   /translation="MHEETVSPSAYRFRPHWEVLPAGTQLWRMHSSRFAAGEFKPFDPK
FT                   DRSPGRFHGTPEDPYPCLYAATDAETALAETLLRSVDYDLEIGMRLILWAQVRGKSLDV
FT                   VRTRCELKLVSLCSGAALAAVCQDNRLLENEGKEHYERTRLWAREIRAQAPEAMGMIWG
FT                   SKRNPSQRALVLFGDRLTDCAGGPLEALPYRSIPDLGSPDGIKEANQLLEPLRSAIKEP
FT                   LHR"
     MHEETVSPSA YRFRPHWEVL PAGTQLWRMH SSRFAAGEFK PFDPKDRSPG RFHGTPEDPY        60
     PCLYAATDAE TALAETLLRS VDYDLEIGMR LILWAQVRGK SLDVVRTRCE LKLVSLCSGA       120
     ALAAVCQDNR LLENEGKEHY ERTRLWAREI RAQAPEAMGM IWGSKRNPSQ RALVLFGDRL       180
     TDCAGGPLEA LPYRSIPDLG SPDGIKEANQ LLEPLRSAIK EPLHR                       225
//

If you have problems or comments...

PBIL Back to PBIL home page