(data stored in ACNUC7421 zone)

EMBL: CP002047.PE540

CP002047.PE540       Location/Qualifiers
FT   CDS             complement(636085..636777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00540"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03661"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0H0"
FT                   /protein_id="ADI03661.1"
FT                   /translation="MTSGEDSGTRVLGLIGEHLDSIRAQLTDEQYQLLLTRLRALADTP
FT                   PDDSRAVRRAFQAVRLCLVPLPFDHPVREALDSVRLVATAPVSRPVVLRTRDLLARLTA
FT                   EPPRPPDTAAVIAAVERRLLRTPALSAAEVRGRYRGSAPPPELIRLADPDLGDRYPEFQ
FT                   FRPGGGAPYEVVLEVNRVLLADADPWGAADWWLSGNAWLGGGPPVALLGVRPDRELVGA
FT                   AVALVEGD"
     MTSGEDSGTR VLGLIGEHLD SIRAQLTDEQ YQLLLTRLRA LADTPPDDSR AVRRAFQAVR        60
     LCLVPLPFDH PVREALDSVR LVATAPVSRP VVLRTRDLLA RLTAEPPRPP DTAAVIAAVE       120
     RRLLRTPALS AAEVRGRYRG SAPPPELIRL ADPDLGDRYP EFQFRPGGGA PYEVVLEVNR       180
     VLLADADPWG AADWWLSGNA WLGGGPPVAL LGVRPDRELV GAAVALVEGD                  230
//

If you have problems or comments...

PBIL Back to PBIL home page