(data stored in ACNUC7421 zone)

EMBL: CP002047.PE541

CP002047.PE541       Location/Qualifiers
FT   CDS             complement(636774..640142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00541"
FT                   /product="hypothetical protein"
FT                   /note="COG4995 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00541"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03662"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0H1"
FT                   /protein_id="ADI03662.1"
FT                   /translation="MGDEGESGGVQAVRTWAGEAIGRARALLPAPGTVAKASRAHDDSV
FT                   TELDALSRLLDHDPELRASVTLWLGGALTLRHGVGGGTPEDRERAHGLLRDVRDPATKT
FT                   GAAASIEDRRWAALFLLTHAMPLQEMLGGLSPEPDATAMFDMIRREGPSGMVAFAAELQ
FT                   ELVTEAAELPLPPENLRQLRQVRDLYTRPSADGIADLFTSLIPDDGFPGNDQLRRTMTD
FT                   WLTTMTGGAGPKSGTAPGTGSDSTGDTRATPDSSDKADAPHPSDEAPAGAPAMPRTPDD
FT                   IRRLIAAWQAVNTTSVDFVDQAGGGDPAALNQQLGRLRDALDGLPDGMPNKDALEGLMA
FT                   LLLSVSDGAGGTLQDQALGLAHTATITDYLRRQSESSIPMADGFALMADVMGLLTEVRT
FT                   AGQAEDEERLRDLLPKAEALADTVPEDHDFRFIALIARAMARLMLGRLTMDRDLLLRGL
FT                   ADFEDGRTAARNSSLPIGHEELEALVPDLATLRSYLTDDTTTIIPDQDVPPPDAPADQL
FT                   HTAANRLGMRYGFTKDPADLEAVITTLEGLREHIRQGRAPRVAAESLWSLADSYRARWH
FT                   REQSESDADAATDAANEALVTLAADVLLQHGAEHRLTTARNGASLGVRAALWAATHGRV
FT                   ADAVAALELGRALVLQAAATSRTVPDLLEERGHPELAAAWRGSGAADSTELPGELPSTL
FT                   RRQALDALGYRERGGLLGTPTFRELADGVAQAGADALIYLVPGSEGDGEAPGMLLAVGP
FT                   EIGIGVGALPMLSEAGSAPLERYLDAADARSRKRDEETERAWEEALSELCDWAYEVFVH
FT                   VLAGLEEHLPGDAADRRTPRVVLVPCGRLGIVPWHAARFPTGAPYDYLCQALVISYAAS
FT                   GSQFLRTVKRAPRDPIAAPAMVADPSLSLMYAEQEVLELRNAFYPGARLYGDFGTLPPD
FT                   SVPTGTPDQLLALLAQDHSMVHLATHGLAGVRPTESALHLAPTDPGEEIGRLTVTRLLD
FT                   RPQAAEEAASDGPLIVLSACQTDLSTRDHDEALTLTTAFVSGGARDVVGSRWTALDSAT
FT                   TLLMAVFHHHLRAGLSPVDALRAAQLWMLDPDRKDPGCLSDTVRHDVRRPDLQRPALWA
FT                   AFIHQGHPGQGKETV"
     MGDEGESGGV QAVRTWAGEA IGRARALLPA PGTVAKASRA HDDSVTELDA LSRLLDHDPE        60
     LRASVTLWLG GALTLRHGVG GGTPEDRERA HGLLRDVRDP ATKTGAAASI EDRRWAALFL       120
     LTHAMPLQEM LGGLSPEPDA TAMFDMIRRE GPSGMVAFAA ELQELVTEAA ELPLPPENLR       180
     QLRQVRDLYT RPSADGIADL FTSLIPDDGF PGNDQLRRTM TDWLTTMTGG AGPKSGTAPG       240
     TGSDSTGDTR ATPDSSDKAD APHPSDEAPA GAPAMPRTPD DIRRLIAAWQ AVNTTSVDFV       300
     DQAGGGDPAA LNQQLGRLRD ALDGLPDGMP NKDALEGLMA LLLSVSDGAG GTLQDQALGL       360
     AHTATITDYL RRQSESSIPM ADGFALMADV MGLLTEVRTA GQAEDEERLR DLLPKAEALA       420
     DTVPEDHDFR FIALIARAMA RLMLGRLTMD RDLLLRGLAD FEDGRTAARN SSLPIGHEEL       480
     EALVPDLATL RSYLTDDTTT IIPDQDVPPP DAPADQLHTA ANRLGMRYGF TKDPADLEAV       540
     ITTLEGLREH IRQGRAPRVA AESLWSLADS YRARWHREQS ESDADAATDA ANEALVTLAA       600
     DVLLQHGAEH RLTTARNGAS LGVRAALWAA THGRVADAVA ALELGRALVL QAAATSRTVP       660
     DLLEERGHPE LAAAWRGSGA ADSTELPGEL PSTLRRQALD ALGYRERGGL LGTPTFRELA       720
     DGVAQAGADA LIYLVPGSEG DGEAPGMLLA VGPEIGIGVG ALPMLSEAGS APLERYLDAA       780
     DARSRKRDEE TERAWEEALS ELCDWAYEVF VHVLAGLEEH LPGDAADRRT PRVVLVPCGR       840
     LGIVPWHAAR FPTGAPYDYL CQALVISYAA SGSQFLRTVK RAPRDPIAAP AMVADPSLSL       900
     MYAEQEVLEL RNAFYPGARL YGDFGTLPPD SVPTGTPDQL LALLAQDHSM VHLATHGLAG       960
     VRPTESALHL APTDPGEEIG RLTVTRLLDR PQAAEEAASD GPLIVLSACQ TDLSTRDHDE      1020
     ALTLTTAFVS GGARDVVGSR WTALDSATTL LMAVFHHHLR AGLSPVDALR AAQLWMLDPD      1080
     RKDPGCLSDT VRHDVRRPDL QRPALWAAFI HQGHPGQGKE TV                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page