(data stored in ACNUC7421 zone)

EMBL: CP002047.PE544

CP002047.PE544       Location/Qualifiers
FT   CDS             641213..641839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00544"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03665"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0H4"
FT                   /protein_id="ADI03665.1"
FT                   /translation="MTTQLRRALPLLLLPLALTLSACGEESVDRSELESRARALGTEPE
FT                   MVYVTDVPGYTLAPQSVGVIGDHGFGGSYTKPGGGTIELRVDERGSSPAGCAESGPDQA
FT                   RGEKQTCERDGESWYRASKSAHEYAREEDGRVIRLSADRESVTRDTLRQAAESLHQADD
FT                   GELAEVLPKGAGDSGGQVGTERGDLPRTGDGAPQDPAGTTEGTSG"
     MTTQLRRALP LLLLPLALTL SACGEESVDR SELESRARAL GTEPEMVYVT DVPGYTLAPQ        60
     SVGVIGDHGF GGSYTKPGGG TIELRVDERG SSPAGCAESG PDQARGEKQT CERDGESWYR       120
     ASKSAHEYAR EEDGRVIRLS ADRESVTRDT LRQAAESLHQ ADDGELAEVL PKGAGDSGGQ       180
     VGTERGDLPR TGDGAPQDPA GTTEGTSG                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page