(data stored in ACNUC7421 zone)

EMBL: CP002047.PE545

CP002047.PE545       Location/Qualifiers
FT   CDS             complement(641860..642273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00545"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03666"
FT                   /db_xref="GOA:D7C0H5"
FT                   /db_xref="InterPro:IPR025597"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0H5"
FT                   /protein_id="ADI03666.1"
FT                   /translation="MARALRVLAQLMGWACVAIGLFHVALGNAAIPGAGSAGATVDSWG
FT                   RFMGAVFAGYGLAWLWAARQRPIPARAVRWLAGVFLLGGVGRLLSLAVHGWPQWFQIAL
FT                   AAIELSLPPVFFWLADAEERTLRGDVEALPAGR"
     MARALRVLAQ LMGWACVAIG LFHVALGNAA IPGAGSAGAT VDSWGRFMGA VFAGYGLAWL        60
     WAARQRPIPA RAVRWLAGVF LLGGVGRLLS LAVHGWPQWF QIALAAIELS LPPVFFWLAD       120
     AEERTLRGDV EALPAGR                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page