(data stored in ACNUC7421 zone)

EMBL: CP002047.PE546

CP002047.PE546       Location/Qualifiers
FT   CDS             642364..643023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00546"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00546"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03667"
FT                   /db_xref="GOA:D7C0H6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0H6"
FT                   /protein_id="ADI03667.1"
FT                   /translation="MPPRQRLTPADRRAQLLAVGARLFAAHPYADVLMEDVAEQAGVSR
FT                   ALLYRHFPSKHALFAAVYQQAADQLLAETRLDPADSLVEQLIQGMDVHLDYFVANRNAV
FT                   LAANRVLAGDPVIQTIMTNELDALRARLLAVLPLADAGARDAVSGVLKSWLVFVQVLCV
FT                   DWLSHETCTRTQLRDICIGAVLGALRPLLTEDPAPDWPPQADGAKIGTGRHSKCAG"
     MPPRQRLTPA DRRAQLLAVG ARLFAAHPYA DVLMEDVAEQ AGVSRALLYR HFPSKHALFA        60
     AVYQQAADQL LAETRLDPAD SLVEQLIQGM DVHLDYFVAN RNAVLAANRV LAGDPVIQTI       120
     MTNELDALRA RLLAVLPLAD AGARDAVSGV LKSWLVFVQV LCVDWLSHET CTRTQLRDIC       180
     IGAVLGALRP LLTEDPAPDW PPQADGAKIG TGRHSKCAG                              219
//

If you have problems or comments...

PBIL Back to PBIL home page