(data stored in ACNUC7421 zone)

EMBL: CP002047.PE548

CP002047.PE548       Location/Qualifiers
FT   CDS             644441..645460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00548"
FT                   /product="glycosyl hydrolase 53 domain protein"
FT                   /note="COG3867 Arabinogalactan endo-1,4-beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00548"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03669"
FT                   /db_xref="GOA:D7C0H8"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011683"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0H8"
FT                   /protein_id="ADI03669.1"
FT                   /translation="MRRRTVLLGAAAGAGTVALGAAAAPAQAEAQAQAAAFVRGADISW
FT                   MPQMEAHGYYWNNSAGVRQDLFAILKGYGITAVSLRTWVNPSSDPANGHCGIEETAQLA
FT                   QRAKNAGMQVLIGFHFGDTWNSAGVQNPPAAWAAMNYSQMLDAMYDYVYHSCNVIKYYG
FT                   VTPAWVKIGNETNSGICKPVGSLSRPDQMTGLLNAAYDMSKKVFPSTPVLVHLAQPQNL
FT                   SGVQNFLNAYRDNGGKWDITGLSSYAQGGNVPGVLANMQTIQAGYGKPVMQVEYGGPVG
FT                   KPAQVRDSLRAFITGLQGFGGLGTFFWEPEGYPSFNSYNSSAWDDSSRRPTAAMDGFI"
     MRRRTVLLGA AAGAGTVALG AAAAPAQAEA QAQAAAFVRG ADISWMPQME AHGYYWNNSA        60
     GVRQDLFAIL KGYGITAVSL RTWVNPSSDP ANGHCGIEET AQLAQRAKNA GMQVLIGFHF       120
     GDTWNSAGVQ NPPAAWAAMN YSQMLDAMYD YVYHSCNVIK YYGVTPAWVK IGNETNSGIC       180
     KPVGSLSRPD QMTGLLNAAY DMSKKVFPST PVLVHLAQPQ NLSGVQNFLN AYRDNGGKWD       240
     ITGLSSYAQG GNVPGVLANM QTIQAGYGKP VMQVEYGGPV GKPAQVRDSL RAFITGLQGF       300
     GGLGTFFWEP EGYPSFNSYN SSAWDDSSRR PTAAMDGFI                              339
//

If you have problems or comments...

PBIL Back to PBIL home page