(data stored in ACNUC7421 zone)

EMBL: CP002047.PE55

CP002047.PE55        Location/Qualifiers
FT   CDS             51462..51962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00055"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03176"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUI5"
FT                   /protein_id="ADI03176.1"
FT                   /translation="MPSATRHNRRSDTPPPRTGSSEVEVLRTLLDYLRTSISAKVDGAP
FT                   EPQVRAAAVPSGTNLLGLLNHLTFVERSMFLGDDVTDWQATFQAAPADSVADIVARYRE
FT                   TVERANDVLDGCTDLGAPVPRPRPGRPAPSVRWALTHMIEETGRHAGQADILRELIDGS
FT                   TGR"
     MPSATRHNRR SDTPPPRTGS SEVEVLRTLL DYLRTSISAK VDGAPEPQVR AAAVPSGTNL        60
     LGLLNHLTFV ERSMFLGDDV TDWQATFQAA PADSVADIVA RYRETVERAN DVLDGCTDLG       120
     APVPRPRPGR PAPSVRWALT HMIEETGRHA GQADILRELI DGSTGR                      166
//

If you have problems or comments...

PBIL Back to PBIL home page