(data stored in ACNUC7421 zone)

EMBL: CP002047.PE553

CP002047.PE553       Location/Qualifiers
FT   CDS             649508..651106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00553"
FT                   /product="secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00553"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03674"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0I3"
FT                   /protein_id="ADI03674.1"
FT                   /translation="MVPQPDILIVGGGLGGVAAALAACRAGRRVVLTEETDWIGGQLTA
FT                   QAVPPDEHPWVERFGTTATYRALREGIRAYYRQWYPLRGEALGLTELNPGAGRVSKLCH
FT                   EPRVALAVLEAMLAPHRASGLLTVLTEHRAVSAEHDNDAITAVTVRDLRDGALRTFAAP
FT                   YVIDATETGELLELAGVEHASGAEAHTEFEEPHAPAQAEPGNQQGITVCFALSHHEGED
FT                   HTVDRPEDYDFWRAYRPDFWPGPLLGFAAPDPRTLEPVPRSFVPNPELDPLAVSADQSA
FT                   DAGDKELWGFRRILARKLHRPGAFDSDITLVNWPLNDYWLKPYIGQEAEALREARQLSL
FT                   SVLYWLQTEAPRADGGTGFQGLRIRPDVTGTADGLAKAAYVRESRRIKAVTTVVEQDVA
FT                   IDVVGPYGTKHYRDSVGVGGYRIDLHPSTGGDTYIDIGSVPFEIPLGALVPRRVRNLLP
FT                   AGKNIGTTHITNGCYRLHPVEWNVGEVAGALAAHCLAEDVAPHQVQAEDKRFEEFGRVL
FT                   DRAGVQRHWPDVRGY"
     MVPQPDILIV GGGLGGVAAA LAACRAGRRV VLTEETDWIG GQLTAQAVPP DEHPWVERFG        60
     TTATYRALRE GIRAYYRQWY PLRGEALGLT ELNPGAGRVS KLCHEPRVAL AVLEAMLAPH       120
     RASGLLTVLT EHRAVSAEHD NDAITAVTVR DLRDGALRTF AAPYVIDATE TGELLELAGV       180
     EHASGAEAHT EFEEPHAPAQ AEPGNQQGIT VCFALSHHEG EDHTVDRPED YDFWRAYRPD       240
     FWPGPLLGFA APDPRTLEPV PRSFVPNPEL DPLAVSADQS ADAGDKELWG FRRILARKLH       300
     RPGAFDSDIT LVNWPLNDYW LKPYIGQEAE ALREARQLSL SVLYWLQTEA PRADGGTGFQ       360
     GLRIRPDVTG TADGLAKAAY VRESRRIKAV TTVVEQDVAI DVVGPYGTKH YRDSVGVGGY       420
     RIDLHPSTGG DTYIDIGSVP FEIPLGALVP RRVRNLLPAG KNIGTTHITN GCYRLHPVEW       480
     NVGEVAGALA AHCLAEDVAP HQVQAEDKRF EEFGRVLDRA GVQRHWPDVR GY               532
//

If you have problems or comments...

PBIL Back to PBIL home page