(data stored in ACNUC7421 zone)

EMBL: CP002047.PE554

CP002047.PE554       Location/Qualifiers
FT   CDS             651169..653301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00554"
FT                   /product="ATP utilising protein"
FT                   /note="COG0145 N-methylhydantoinase A/acetone carboxylase,
FT                   beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00554"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03675"
FT                   /db_xref="GOA:D7C0I4"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0I4"
FT                   /protein_id="ADI03675.1"
FT                   /translation="MPPDRRVRVGIDVGGTFTDAVAVDAATLELVGQVKVPTSHHHEDG
FT                   VAHGIVQALDHLLEQAGRTPAEVTFLAHGTTQATNALLEGDVAKVGLIGIGTGAGAVFT
FT                   RRLAAFGKLELAPGKLLPLVYAHVADPFDGDAVRAAVTRVQEEGAEVLVASEPFGVDRP
FT                   EGEQAVLDAARPTGLPVAAAHEITSLYGLHKRTRTAVVNAAILPRMLATADLVDSAITK
FT                   AGVTAPLMVMRCDGGVMSLDEMRRRPLLTVLSGPAAGVAGALMQERISEGVFLETGGTS
FT                   TDISVVRRGKVAVRHATILGKASYLNALDVRTVGVGGGSMVRVSGGKVTGVGPRSAHIA
FT                   GLRYACFASLDELRDAKVATVRPMDGDPDDYLVLDAAGGRFAVTMTCAANALGRVPEGD
FT                   FARCDPEVARAALAPPAAMLGMDVAGAARAVLDAGTASVRTVVDAMIRDYRLDRETAVL
FT                   VGGGGGAAAVTPHLAQAAGLEGRIARHNEVISPIGVALALVREQVERIIPGATQEQILA
FT                   VRAEAERAVVAQGAAADGVEVEVTVDPQTSTVRAVATGATELRTQDRAHRADDAERLRV
FT                   AAASLKAQELRVKILAGTDAYTVYGTEVRRRLRAARRPVRVVDADGVVRLGVSDAQVTT
FT                   TTVGAAGETLASLVRDATSYGDGGVRAPAVRLLVGGRIADLSGVLEPGALLALARSELR
FT                   ARAADEPVIAVVESRV"
     MPPDRRVRVG IDVGGTFTDA VAVDAATLEL VGQVKVPTSH HHEDGVAHGI VQALDHLLEQ        60
     AGRTPAEVTF LAHGTTQATN ALLEGDVAKV GLIGIGTGAG AVFTRRLAAF GKLELAPGKL       120
     LPLVYAHVAD PFDGDAVRAA VTRVQEEGAE VLVASEPFGV DRPEGEQAVL DAARPTGLPV       180
     AAAHEITSLY GLHKRTRTAV VNAAILPRML ATADLVDSAI TKAGVTAPLM VMRCDGGVMS       240
     LDEMRRRPLL TVLSGPAAGV AGALMQERIS EGVFLETGGT STDISVVRRG KVAVRHATIL       300
     GKASYLNALD VRTVGVGGGS MVRVSGGKVT GVGPRSAHIA GLRYACFASL DELRDAKVAT       360
     VRPMDGDPDD YLVLDAAGGR FAVTMTCAAN ALGRVPEGDF ARCDPEVARA ALAPPAAMLG       420
     MDVAGAARAV LDAGTASVRT VVDAMIRDYR LDRETAVLVG GGGGAAAVTP HLAQAAGLEG       480
     RIARHNEVIS PIGVALALVR EQVERIIPGA TQEQILAVRA EAERAVVAQG AAADGVEVEV       540
     TVDPQTSTVR AVATGATELR TQDRAHRADD AERLRVAAAS LKAQELRVKI LAGTDAYTVY       600
     GTEVRRRLRA ARRPVRVVDA DGVVRLGVSD AQVTTTTVGA AGETLASLVR DATSYGDGGV       660
     RAPAVRLLVG GRIADLSGVL EPGALLALAR SELRARAADE PVIAVVESRV                  710
//

If you have problems or comments...

PBIL Back to PBIL home page