(data stored in ACNUC7421 zone)

EMBL: CP002047.PE555

CP002047.PE555       Location/Qualifiers
FT   CDS             653298..653888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00555"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03676"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0I5"
FT                   /protein_id="ADI03676.1"
FT                   /translation="MSGDHGLSLGHDPDLDHDHDLDLAVRLLAGTPTHEGRDPLLLRRW
FT                   AEAAEEFGRRMTPDPAPVRVVERDGGLAAGLLARYRSRPPVVEVYVDTVDRAERLITQR
FT                   GWRHWFPEGSVLAAALAHEQAHAWLHHAHVRAEFKRALGHTALRLGRRRLYAHVAGADE
FT                   LAAHAYARAACGLGRSPLLLTEALAAACSESEK"
     MSGDHGLSLG HDPDLDHDHD LDLAVRLLAG TPTHEGRDPL LLRRWAEAAE EFGRRMTPDP        60
     APVRVVERDG GLAAGLLARY RSRPPVVEVY VDTVDRAERL ITQRGWRHWF PEGSVLAAAL       120
     AHEQAHAWLH HAHVRAEFKR ALGHTALRLG RRRLYAHVAG ADELAAHAYA RAACGLGRSP       180
     LLLTEALAAA CSESEK                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page