(data stored in ACNUC7421 zone)

EMBL: CP002047.PE556

CP002047.PE556       Location/Qualifiers
FT   CDS             653892..655178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00556"
FT                   /product="transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00556"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03677"
FT                   /db_xref="GOA:D7C0I6"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0I6"
FT                   /protein_id="ADI03677.1"
FT                   /translation="MGVVILLLMAAGVAAMLTRRLPTAFALVLLAVAIAFAAGAPLTGK
FT                   NSVLDTVLQEGAPALAATMIAILLGSWLGKLLEETGIAATLVRKIVEFGGDRPVFVALG
FT                   VLAVSALVGTVTGSAPAAMLAGLIGIPAMIAVGIPKVTAAGTILMGIAVGIPFELPVWQ
FT                   FFSTALELPVDTVRGFMLKLFPFALVAAVAYVLVESRRRGVEHTWSLTSVRGESKPRSR
FT                   RQLLGDAPWYALLTPVVPLVLALGFELAIIPSLLAGVLYALVTTTPPREMNRRLLRTLY
FT                   GGFEVAAAPITLFVAIGILLAAVKLPGAVDALEPLVKAVSPQNAVLFVLVFTLLVPLCL
FT                   YRGPLNVFGLGAGIAGVLIATGIYPATAVLGMATSYNQVFGVADPTSTQTVWSAQYAGV
FT                   SPQQVMVRTLPYVWAVALGGLCVTAATQL"
     MGVVILLLMA AGVAAMLTRR LPTAFALVLL AVAIAFAAGA PLTGKNSVLD TVLQEGAPAL        60
     AATMIAILLG SWLGKLLEET GIAATLVRKI VEFGGDRPVF VALGVLAVSA LVGTVTGSAP       120
     AAMLAGLIGI PAMIAVGIPK VTAAGTILMG IAVGIPFELP VWQFFSTALE LPVDTVRGFM       180
     LKLFPFALVA AVAYVLVESR RRGVEHTWSL TSVRGESKPR SRRQLLGDAP WYALLTPVVP       240
     LVLALGFELA IIPSLLAGVL YALVTTTPPR EMNRRLLRTL YGGFEVAAAP ITLFVAIGIL       300
     LAAVKLPGAV DALEPLVKAV SPQNAVLFVL VFTLLVPLCL YRGPLNVFGL GAGIAGVLIA       360
     TGIYPATAVL GMATSYNQVF GVADPTSTQT VWSAQYAGVS PQQVMVRTLP YVWAVALGGL       420
     CVTAATQL                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page