(data stored in ACNUC7421 zone)

EMBL: CP002047.PE559

CP002047.PE559       Location/Qualifiers
FT   CDS             657183..657575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00559"
FT                   /product="AraC family transcriptional regulator"
FT                   /note="COG2207 AraC-type DNA-binding domain-containing
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00559"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03680"
FT                   /db_xref="GOA:D7C0I9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0I9"
FT                   /protein_id="ADI03680.1"
FT                   /translation="MADEDLLTDPVLPVRWVRLVTARPVPAQALGYPGVALTPDQAVLH
FT                   TLFRRQEETVAASIRRRRLERCHADLTDPRLRRRSISAIAARWGFVRPADFSRAFRAAY
FT                   GVAPRELRQAALRNPPDTRQAAPGDK"
     MADEDLLTDP VLPVRWVRLV TARPVPAQAL GYPGVALTPD QAVLHTLFRR QEETVAASIR        60
     RRRLERCHAD LTDPRLRRRS ISAIAARWGF VRPADFSRAF RAAYGVAPRE LRQAALRNPP       120
     DTRQAAPGDK                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page