(data stored in ACNUC7421 zone)

EMBL: CP002047.PE56

CP002047.PE56        Location/Qualifiers
FT   CDS             52326..53927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00056"
FT                   /product="Rab family protein"
FT                   /note="COG4886 Leucine-rich repeat (LRR) protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00056"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03177"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUI6"
FT                   /protein_id="ADI03177.1"
FT                   /translation="MHEDIWGDPTRYRYAAAPRTGLSLPLDDSLERAIQEAAEASGSED
FT                   QVEFLMVEGQRLTDLRPLARLRGLRELVVHSPVLKDLGPLALLPTLRRLSVTAPVSDLG
FT                   PLSALTSLTHLDLEQTMVTDLAPLASLAKLRDLSVTQGPLADLGPLRRLGLMRLYVYRT
FT                   QVTDLTPLADAPLLWVLGINDCPVTDVSVLTQLPSLTHVLMRRTRVKDLGDLPTRAPHI
FT                   TFEGYDEKSPEPTVTPDTPGDPIDPIDPAELLARYRAAEDKERYRLGLRLLGSRDAVAI
FT                   EALIRELLSDSDRFTMRGLLLDGGHGSIPFPANPWGIPADADLDAAIGHIWAPLADHLP
FT                   TFLDILRHETLALGLLTDQDGQPSLAYVFVGWNPLPGRVRLDDLSHWREDEGALRIVHG
FT                   GAPRTDIDPYLVVPVLGGPVPTPLRELWAVHRFLGDGFQAQYDDRLTTNLGAFCSRNLP
FT                   GFAERNNGAQPDRFVLFASQDYYNAVLDLDILDQAGNPTITTWIDWEIGARQQFWDWFD
FT                   AELPDTALLGLRREAR"
     MHEDIWGDPT RYRYAAAPRT GLSLPLDDSL ERAIQEAAEA SGSEDQVEFL MVEGQRLTDL        60
     RPLARLRGLR ELVVHSPVLK DLGPLALLPT LRRLSVTAPV SDLGPLSALT SLTHLDLEQT       120
     MVTDLAPLAS LAKLRDLSVT QGPLADLGPL RRLGLMRLYV YRTQVTDLTP LADAPLLWVL       180
     GINDCPVTDV SVLTQLPSLT HVLMRRTRVK DLGDLPTRAP HITFEGYDEK SPEPTVTPDT       240
     PGDPIDPIDP AELLARYRAA EDKERYRLGL RLLGSRDAVA IEALIRELLS DSDRFTMRGL       300
     LLDGGHGSIP FPANPWGIPA DADLDAAIGH IWAPLADHLP TFLDILRHET LALGLLTDQD       360
     GQPSLAYVFV GWNPLPGRVR LDDLSHWRED EGALRIVHGG APRTDIDPYL VVPVLGGPVP       420
     TPLRELWAVH RFLGDGFQAQ YDDRLTTNLG AFCSRNLPGF AERNNGAQPD RFVLFASQDY       480
     YNAVLDLDIL DQAGNPTITT WIDWEIGARQ QFWDWFDAEL PDTALLGLRR EAR              533
//

If you have problems or comments...

PBIL Back to PBIL home page