(data stored in ACNUC7421 zone)

EMBL: CP002047.PE560

CP002047.PE560       Location/Qualifiers
FT   CDS             complement(657632..658252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00560"
FT                   /product="hypothetical protein"
FT                   /note="COG0009 Putative translation factor (SUA5)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00560"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03681"
FT                   /db_xref="GOA:D7C0J0"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0J0"
FT                   /protein_id="ADI03681.1"
FT                   /translation="MAKYFDVHPENPQQRTIGNVADRIRSGALVAYPTDSCFALGCLMG
FT                   NREGINRIRSIRNLDDRHHFTLVCQNFAQLGQFVHIDKDVFRAIKAATPGSYTFILPAT
FT                   KEVPRQLPHPKKKTVGVRIPDHVVAQALLADLGEPLLSSTLLLPGEDEPMTQGWEIKDR
FT                   LDHVVDAVVDSGDCGTEPTTVIDFSSGEAEIVRRGAGDTARFE"
     MAKYFDVHPE NPQQRTIGNV ADRIRSGALV AYPTDSCFAL GCLMGNREGI NRIRSIRNLD        60
     DRHHFTLVCQ NFAQLGQFVH IDKDVFRAIK AATPGSYTFI LPATKEVPRQ LPHPKKKTVG       120
     VRIPDHVVAQ ALLADLGEPL LSSTLLLPGE DEPMTQGWEI KDRLDHVVDA VVDSGDCGTE       180
     PTTVIDFSSG EAEIVRRGAG DTARFE                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page