(data stored in ACNUC7421 zone)

EMBL: CP002047.PE562

CP002047.PE562       Location/Qualifiers
FT   CDS             complement(658665..659969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00562"
FT                   /product="hydrolytic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00562"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03683"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0J2"
FT                   /protein_id="ADI03683.1"
FT                   /translation="MRRAVTLPGTAGTPDPSALAPLGAERTERTETGAAGATGAAVEAD
FT                   TAEQPKASLNEPASAGESVESVTPGAESVESATPGAAGAATASAGATAASEAGAPDTPA
FT                   APDVPPAEADGHADGHGSADGMASAEGDYPPGADTGADEDEPPSGRPTKALLAAAAIAG
FT                   ALLITVPFLAFGADDDDHKTEAAPEPTSGMTVPKIEEKGPGTYTAQSPAPSPTKESKSP
FT                   SPAAKPRPEPSSEQPKSRPEPEPEPSSEQPKPRAKKVVPASKPYLLAPEQRTNFQLKNV
FT                   TTGRCADLPGMGKGKLDGAVLQHDCFADWNADNQVWDFVLAQKGKGPNGRNLVVIKNKK
FT                   SGLCLDLPQRGSQPSRTALNQTHCNLTLQDNQLWWVENRGGNRTFWIHNYASDQRCLEV
FT                   WGEKPDFGGNDARLGIYKCSPTDDHEWRLMSKGES"
     MRRAVTLPGT AGTPDPSALA PLGAERTERT ETGAAGATGA AVEADTAEQP KASLNEPASA        60
     GESVESVTPG AESVESATPG AAGAATASAG ATAASEAGAP DTPAAPDVPP AEADGHADGH       120
     GSADGMASAE GDYPPGADTG ADEDEPPSGR PTKALLAAAA IAGALLITVP FLAFGADDDD       180
     HKTEAAPEPT SGMTVPKIEE KGPGTYTAQS PAPSPTKESK SPSPAAKPRP EPSSEQPKSR       240
     PEPEPEPSSE QPKPRAKKVV PASKPYLLAP EQRTNFQLKN VTTGRCADLP GMGKGKLDGA       300
     VLQHDCFADW NADNQVWDFV LAQKGKGPNG RNLVVIKNKK SGLCLDLPQR GSQPSRTALN       360
     QTHCNLTLQD NQLWWVENRG GNRTFWIHNY ASDQRCLEVW GEKPDFGGND ARLGIYKCSP       420
     TDDHEWRLMS KGES                                                         434
//

If you have problems or comments...

PBIL Back to PBIL home page