(data stored in ACNUC7421 zone)

EMBL: CP002047.PE563

CP002047.PE563       Location/Qualifiers
FT   CDS             complement(660033..663233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00563"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03684"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0J3"
FT                   /protein_id="ADI03684.1"
FT                   /translation="MSRSGGARARWFSRRGARARTGPAADPAPSAPVTTLDRSERPGGG
FT                   GRGRGGALLVEEYGGVMLLRSPADDTLSTSDVADLARALSVDPEHTVTVVAGADASSAG
FT                   ELWPRLGRVLDSLRSDGVGVVRLVLAAAGDDRPDEPAVARRIADAWEIEVIAPDGVAVV
FT                   VPGGSLFVPERRSGRGVARGGGERGGWWRFAPGVEPVRIGSRQPAPAWQPAVEYLPVGT
FT                   SGGYAVEQIPAGVLVRSRDAIPPRPDDLCYAVPADPRGPTVLLGAPHDEDIPAGDLTEL
FT                   LTALPEAVRPRVRLAPGGPRDILRTSQSVADSLGVELLVRTGMPLMSYGIPTEPGTVRS
FT                   VLVGADGAPRWQPFVDTVVCAPAREGETAPSPRLSRWSPPVPGRGSAEHGAIRLSEQWR
FT                   VTVTRAGLWITDTESEPPPATARAVDPEGPAIELGHPGRPIDATLYPVLGKLLGGLGAD
FT                   VCGRARLFVLGTCADGGRELRRIAAEHGLRTLRFGAGLAPARPEVRRPAPAESAEAPTE
FT                   PGPAPVASAPAAEAEPEPDHERDPMSLGTLPEATPQEARLPEATPLETTEDPRPVFPPT
FT                   RPSMVSTASAPVAAPAAHDTSAAPGEPAVSATSGAGAGPGPESSRPRTGGPGPSRPPGS
FT                   GRVRDPERPEPPGADRPLRTGSGTPPPPMEPDQRSQSLPPMGLDAMLDLLRSQSPPDGA
FT                   GDGDSAPSVSPLTRRPTQQGAPLSRPSQGQAPQATPNTPATPATRTPPASPESSEPPAL
FT                   AEPPAAPVSPAAPLSTTGSQSTQAPPPTTAPEPTTPVTPATPEPPAPEPPAAPLRPLPP
FT                   VPFLPGHVSTEAERTAFRALADAVWERHSAAVTRALTRMPALRGPEQEAARIDLIALHM
FT                   YLDTSYDLDTPDAPDTPAAGLSQDALARGMRTGDERLLPYAACVASALRRLPSYRGLAC
FT                   RRTHEADGGLVPGTLLRDPAPVCALPPGAGAPRPAGAQYAIWSVTGRRTRQLTGRPGSA
FT                   SGGDEVVFAPGTLLRVLDVRDTAGAPLVLLREVPTTASSPSAAGAVPQDTRLDDHDRAA
FT                   LDRLDEALRRHRPAATHG"
     MSRSGGARAR WFSRRGARAR TGPAADPAPS APVTTLDRSE RPGGGGRGRG GALLVEEYGG        60
     VMLLRSPADD TLSTSDVADL ARALSVDPEH TVTVVAGADA SSAGELWPRL GRVLDSLRSD       120
     GVGVVRLVLA AAGDDRPDEP AVARRIADAW EIEVIAPDGV AVVVPGGSLF VPERRSGRGV       180
     ARGGGERGGW WRFAPGVEPV RIGSRQPAPA WQPAVEYLPV GTSGGYAVEQ IPAGVLVRSR       240
     DAIPPRPDDL CYAVPADPRG PTVLLGAPHD EDIPAGDLTE LLTALPEAVR PRVRLAPGGP       300
     RDILRTSQSV ADSLGVELLV RTGMPLMSYG IPTEPGTVRS VLVGADGAPR WQPFVDTVVC       360
     APAREGETAP SPRLSRWSPP VPGRGSAEHG AIRLSEQWRV TVTRAGLWIT DTESEPPPAT       420
     ARAVDPEGPA IELGHPGRPI DATLYPVLGK LLGGLGADVC GRARLFVLGT CADGGRELRR       480
     IAAEHGLRTL RFGAGLAPAR PEVRRPAPAE SAEAPTEPGP APVASAPAAE AEPEPDHERD       540
     PMSLGTLPEA TPQEARLPEA TPLETTEDPR PVFPPTRPSM VSTASAPVAA PAAHDTSAAP       600
     GEPAVSATSG AGAGPGPESS RPRTGGPGPS RPPGSGRVRD PERPEPPGAD RPLRTGSGTP       660
     PPPMEPDQRS QSLPPMGLDA MLDLLRSQSP PDGAGDGDSA PSVSPLTRRP TQQGAPLSRP       720
     SQGQAPQATP NTPATPATRT PPASPESSEP PALAEPPAAP VSPAAPLSTT GSQSTQAPPP       780
     TTAPEPTTPV TPATPEPPAP EPPAAPLRPL PPVPFLPGHV STEAERTAFR ALADAVWERH       840
     SAAVTRALTR MPALRGPEQE AARIDLIALH MYLDTSYDLD TPDAPDTPAA GLSQDALARG       900
     MRTGDERLLP YAACVASALR RLPSYRGLAC RRTHEADGGL VPGTLLRDPA PVCALPPGAG       960
     APRPAGAQYA IWSVTGRRTR QLTGRPGSAS GGDEVVFAPG TLLRVLDVRD TAGAPLVLLR      1020
     EVPTTASSPS AAGAVPQDTR LDDHDRAALD RLDEALRRHR PAATHG                     1066
//

If you have problems or comments...

PBIL Back to PBIL home page