(data stored in ACNUC7421 zone)

EMBL: CP002047.PE564

CP002047.PE564       Location/Qualifiers
FT   CDS             complement(663230..663964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00564"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03685"
FT                   /db_xref="InterPro:IPR009839"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0J4"
FT                   /protein_id="ADI03685.1"
FT                   /translation="MSESNGEATTPATSGEAPATSGETPATVDPAPPEEFVQAAKAAPN
FT                   HWLYLTDPTWRGEAPPPEFAVVGQWRSDDNGEIVEWQANEDYVPSPGARGWPEPTDDVD
FT                   RAVQLATTGYGPADDVTAALAKAELAMLVTADGRPVSASAADGTAVVPIYTSARHLHKT
FT                   GPLGFERVRIADVLDRIPEGHNVCVNSSAAVSMVLITDKLVQALAAVESAPAEEADGSE
FT                   RAEADQAEAGQADAREERGGQA"
     MSESNGEATT PATSGEAPAT SGETPATVDP APPEEFVQAA KAAPNHWLYL TDPTWRGEAP        60
     PPEFAVVGQW RSDDNGEIVE WQANEDYVPS PGARGWPEPT DDVDRAVQLA TTGYGPADDV       120
     TAALAKAELA MLVTADGRPV SASAADGTAV VPIYTSARHL HKTGPLGFER VRIADVLDRI       180
     PEGHNVCVNS SAAVSMVLIT DKLVQALAAV ESAPAEEADG SERAEADQAE AGQADAREER       240
     GGQA                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page