(data stored in ACNUC7421 zone)

EMBL: CP002047.PE565

CP002047.PE565       Location/Qualifiers
FT   CDS             complement(664015..666369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00565"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03686"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0J5"
FT                   /protein_id="ADI03686.1"
FT                   /translation="MWLADDDFKQAGPLMLDLLRQVIVGHAGPGVMGDQDVVRRVLAAA
FT                   ATAGKAGVPFRDFVDLPVVRLAAGWLNGGGAQSEAVDALKPSGPDQQLGEVERSRMFWA
FT                   WVKTMDLLSAPGMDMDKVDKLAVRVLHLDPDHDVEPHHRERLRVRLTQAFAVGRGASDP
FT                   DVAAAYALEEEYGAFTGTGLDTVQDGARGSGLDFTGQPRSGTVNLAQILAPGGLKNAPW
FT                   RHQGPNQQATEPAPYLVRIELDELDPDSILLVIGDAVLQMPVREFLELMANDLTLTGKE
FT                   EGTLIVLSHAWPAPGIGEVARRLAQRLGREVGWTDTPTDLSGKDDQNRSVLTVLAASDA
FT                   VWRKAEVEAPQPPVPNAPRPIPRPYPRSGPPGPAAPTAAPPTTATTTRPTALGSAAPSG
FT                   LAAASSATPPGEKPEDPASFLDDGVPSEPEESEESALSGAPPASPWDMARIRYAEEALD
FT                   YEERLVTYLAADERINAEFARVVEAFWALVLHNGMDYRKFGSELPSENGAVGTSFESLQ
FT                   RVVESGNLRERADFLFAGAANGLLPDLTGGRVRRHPVVMGERDDRRKTEAYTRYKQRTE
FT                   ELRALGIDDAVIAEEVEDLMAVVRTPLRPEDVRPPLSQDERLIAVRASDGKLLWMPAGL
FT                   SEELPMSAGLQQRSQESGGLVLTGTSGSTHFILTLVARLSNLANFPVDLGLIRAGLVST
FT                   MAYVGDHSFHEVMAGAQLVLDEVAHPGVPDYVDGRYRYRNVYPLTEEELRAHVARDGLF
FT                   PDEHAMALFAELDDGAEEGSESDDGDDSSDR"
     MWLADDDFKQ AGPLMLDLLR QVIVGHAGPG VMGDQDVVRR VLAAAATAGK AGVPFRDFVD        60
     LPVVRLAAGW LNGGGAQSEA VDALKPSGPD QQLGEVERSR MFWAWVKTMD LLSAPGMDMD       120
     KVDKLAVRVL HLDPDHDVEP HHRERLRVRL TQAFAVGRGA SDPDVAAAYA LEEEYGAFTG       180
     TGLDTVQDGA RGSGLDFTGQ PRSGTVNLAQ ILAPGGLKNA PWRHQGPNQQ ATEPAPYLVR       240
     IELDELDPDS ILLVIGDAVL QMPVREFLEL MANDLTLTGK EEGTLIVLSH AWPAPGIGEV       300
     ARRLAQRLGR EVGWTDTPTD LSGKDDQNRS VLTVLAASDA VWRKAEVEAP QPPVPNAPRP       360
     IPRPYPRSGP PGPAAPTAAP PTTATTTRPT ALGSAAPSGL AAASSATPPG EKPEDPASFL       420
     DDGVPSEPEE SEESALSGAP PASPWDMARI RYAEEALDYE ERLVTYLAAD ERINAEFARV       480
     VEAFWALVLH NGMDYRKFGS ELPSENGAVG TSFESLQRVV ESGNLRERAD FLFAGAANGL       540
     LPDLTGGRVR RHPVVMGERD DRRKTEAYTR YKQRTEELRA LGIDDAVIAE EVEDLMAVVR       600
     TPLRPEDVRP PLSQDERLIA VRASDGKLLW MPAGLSEELP MSAGLQQRSQ ESGGLVLTGT       660
     SGSTHFILTL VARLSNLANF PVDLGLIRAG LVSTMAYVGD HSFHEVMAGA QLVLDEVAHP       720
     GVPDYVDGRY RYRNVYPLTE EELRAHVARD GLFPDEHAMA LFAELDDGAE EGSESDDGDD       780
     SSDR                                                                    784
//

If you have problems or comments...

PBIL Back to PBIL home page