(data stored in ACNUC7421 zone)

EMBL: CP002047.PE567

CP002047.PE567       Location/Qualifiers
FT   CDS             complement(722830..723243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00567"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03688"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0J7"
FT                   /protein_id="ADI03688.1"
FT                   /translation="MSDDTYDMNLGKMRGALNGLAGLGDRARVLEGQYLADHERYKLWN
FT                   GDSSHPDDYYEKTQPDDEKTTQTLIGTIKSLGLAITAAHSALLESLDSVKAVHADVTEL
FT                   IEQQERIADDDSGYESDDSGYGSGDDESGGGKH"
     MSDDTYDMNL GKMRGALNGL AGLGDRARVL EGQYLADHER YKLWNGDSSH PDDYYEKTQP        60
     DDEKTTQTLI GTIKSLGLAI TAAHSALLES LDSVKAVHAD VTELIEQQER IADDDSGYES       120
     DDSGYGSGDD ESGGGKH                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page