(data stored in ACNUC7421 zone)

EMBL: CP002047.PE568

CP002047.PE568       Location/Qualifiers
FT   CDS             complement(723240..723713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00568"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03689"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0J8"
FT                   /protein_id="ADI03689.1"
FT                   /translation="MSELNDPYAERIHQARAHLEATRAAIARAEQDLADHNVTARSRDR
FT                   AVEVTIGPQGELSGLTFLDNKYLSMTGPQLAASVLEAAQRGRQQVAQRVMDTFRPLMAA
FT                   NPDVPGSRDIDVDWDRLFGSAFEGGRRAGGGRSSSDRLRDEIHEDPDVPGGRP"
     MSELNDPYAE RIHQARAHLE ATRAAIARAE QDLADHNVTA RSRDRAVEVT IGPQGELSGL        60
     TFLDNKYLSM TGPQLAASVL EAAQRGRQQV AQRVMDTFRP LMAANPDVPG SRDIDVDWDR       120
     LFGSAFEGGR RAGGGRSSSD RLRDEIHEDP DVPGGRP                                157
//

If you have problems or comments...

PBIL Back to PBIL home page