(data stored in ACNUC7421 zone)

EMBL: CP002047.PE569

CP002047.PE569       Location/Qualifiers
FT   CDS             complement(723778..724728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00569"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03690"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0J9"
FT                   /protein_id="ADI03690.1"
FT                   /translation="MSHDLITGPVNGDDSLHNPGGSESHIDSHGRVVTEYPDGHTTTID
FT                   PDNQTSSITTPDGHTRSGPLNVDNVLNNPDGSRSHIDPQGQVVTEYPDGSKTTIDPDTG
FT                   GTSITDPDGKSVTGHLNGSGNSLPDFQQQSPGSNFGNIGGGGSGNSNSLYDPSSYEEEL
FT                   WDKDPYQSPGDQNGNGNNQAAANAGNQNQSGAPMGGGMPLNPGTMPGRGGGGGGGEGGP
FT                   SERVRNVIDSGDVVSNRRATPRPGRPGGGLLDERENVITSGGTPFMPPMGGAGGAGSPG
FT                   QVATQTDDRERESWVPEDEDVWGSDEGGSPAVIGR"
     MSHDLITGPV NGDDSLHNPG GSESHIDSHG RVVTEYPDGH TTTIDPDNQT SSITTPDGHT        60
     RSGPLNVDNV LNNPDGSRSH IDPQGQVVTE YPDGSKTTID PDTGGTSITD PDGKSVTGHL       120
     NGSGNSLPDF QQQSPGSNFG NIGGGGSGNS NSLYDPSSYE EELWDKDPYQ SPGDQNGNGN       180
     NQAAANAGNQ NQSGAPMGGG MPLNPGTMPG RGGGGGGGEG GPSERVRNVI DSGDVVSNRR       240
     ATPRPGRPGG GLLDERENVI TSGGTPFMPP MGGAGGAGSP GQVATQTDDR ERESWVPEDE       300
     DVWGSDEGGS PAVIGR                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page