(data stored in ACNUC7421 zone)

EMBL: CP002047.PE57

CP002047.PE57        Location/Qualifiers
FT   CDS             54210..54635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00057"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03178"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUI7"
FT                   /protein_id="ADI03178.1"
FT                   /translation="MRADDSTARPGRLVWMDTDLWKQQVKRRAEDDGLARARSRVLEAL
FT                   LTAYAEGSLDAPVPAGSTFGTAERGGCRVYLAESVCERAETRWKRQEQARRGGVPGFGL
FT                   LCEVLLREYAEGRVELRITAAPAGSTGSTGNTGSMAA"
     MRADDSTARP GRLVWMDTDL WKQQVKRRAE DDGLARARSR VLEALLTAYA EGSLDAPVPA        60
     GSTFGTAERG GCRVYLAESV CERAETRWKR QEQARRGGVP GFGLLCEVLL REYAEGRVEL       120
     RITAAPAGST GSTGNTGSMA A                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page