(data stored in ACNUC7421 zone)

EMBL: CP002047.PE570

CP002047.PE570       Location/Qualifiers
FT   CDS             724765..725325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00570"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03691"
FT                   /db_xref="GOA:D7C0K0"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0K0"
FT                   /protein_id="ADI03691.1"
FT                   /translation="MVERLLLLFLVLLLLLLVLVLLVLLLLLLLLVLLVLVLPLPLLVL
FT                   LVPLLLLFLLLLLPLLLLLLVLLLLLLVLLLLLLLLRLLGLGLLLLLSLLFLELLLLLL
FT                   LLFLELLLLGSWLPLTTSPMTMGSQRTLVRLYFQTSLVTSLSTSMSQTSGLPWSSRQSS
FT                   LQVRKRPSAAVRTSARKRRRSLP"
     MVERLLLLFL VLLLLLLVLV LLVLLLLLLL LVLLVLVLPL PLLVLLVPLL LLFLLLLLPL        60
     LLLLLVLLLL LLVLLLLLLL LRLLGLGLLL LLSLLFLELL LLLLLLFLEL LLLGSWLPLT       120
     TSPMTMGSQR TLVRLYFQTS LVTSLSTSMS QTSGLPWSSR QSSLQVRKRP SAAVRTSARK       180
     RRRSLP                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page