(data stored in ACNUC7421 zone)

EMBL: CP002047.PE572

CP002047.PE572       Location/Qualifiers
FT   CDS             725579..727690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00572"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03693"
FT                   /db_xref="GOA:D7C0K2"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0K2"
FT                   /protein_id="ADI03693.1"
FT                   /translation="MLVLLLLLLLLLLLGLGLFLLLFLLGLLLRLLLLSLLLRLRLLLL
FT                   LLLLLLFLLGLLLRLLLLSLLLRLGLLLLLLLLLLLLLGLSLGLLLFLLLLLRRSLGFG
FT                   FLLLLFLLLLLRRSLGFGFLLLLFLLLLLLLLLGLSLGLLLFLLLLLRRSLGFGFLLLL
FT                   FLLLLLLLLLGLLLLHVLLLLGLGFLLLPLLLSLGLGLLLLPLLLLLLLLLPVLLLFLL
FT                   LLLPVLLLLLLPLLLLLLLILLLLLRLLLLLVGHVVVVLLGQAVPARRLDRAKIEYRGA
FT                   PRVVHRPQREVGVVDQVFLDGFLPPLDRRLADRLPGIQTVQRAVVVALFVDGILAEITG
FT                   GVIGGFRFATGTGMHFVGDVRDVVVPHVVGDLRQQVGEEAQRVTIFRFPRSPVLLESPG
FT                   RFLEHVTCDPDGVARYGKQRTVAQVVGVVLVPLVQHVDEMPEDAGCRALPRLVLLHPDP
FT                   LVPFLQFCLAVGVEQGDTIEGGRRPVERRQIDDPFGGHGYSVPLEASRTTVVVEQSLKG
FT                   PARSVGVLRVRAGVPLRPLVRLLEVVVVPGLVLAPLVHTAGRPVFDVVVAQEREPGLVI
FT                   GDFVPRRFLAGLLLVPRLVEGDHEVCVAYVATRVIDTPLKVIHIDVGDALLLGELHLHQ
FT                   RDVVVAEPLLKQRVDLWRFVTGEIVDRLLPTITFLGKRHGGASIGRGNEGGCGVLRHSA
FT                   GTTTAHLLS"
     MLVLLLLLLL LLLLGLGLFL LLFLLGLLLR LLLLSLLLRL RLLLLLLLLL LFLLGLLLRL        60
     LLLSLLLRLG LLLLLLLLLL LLLGLSLGLL LFLLLLLRRS LGFGFLLLLF LLLLLRRSLG       120
     FGFLLLLFLL LLLLLLLGLS LGLLLFLLLL LRRSLGFGFL LLLFLLLLLL LLLGLLLLHV       180
     LLLLGLGFLL LPLLLSLGLG LLLLPLLLLL LLLLPVLLLF LLLLLPVLLL LLLPLLLLLL       240
     LILLLLLRLL LLLVGHVVVV LLGQAVPARR LDRAKIEYRG APRVVHRPQR EVGVVDQVFL       300
     DGFLPPLDRR LADRLPGIQT VQRAVVVALF VDGILAEITG GVIGGFRFAT GTGMHFVGDV       360
     RDVVVPHVVG DLRQQVGEEA QRVTIFRFPR SPVLLESPGR FLEHVTCDPD GVARYGKQRT       420
     VAQVVGVVLV PLVQHVDEMP EDAGCRALPR LVLLHPDPLV PFLQFCLAVG VEQGDTIEGG       480
     RRPVERRQID DPFGGHGYSV PLEASRTTVV VEQSLKGPAR SVGVLRVRAG VPLRPLVRLL       540
     EVVVVPGLVL APLVHTAGRP VFDVVVAQER EPGLVIGDFV PRRFLAGLLL VPRLVEGDHE       600
     VCVAYVATRV IDTPLKVIHI DVGDALLLGE LHLHQRDVVV AEPLLKQRVD LWRFVTGEIV       660
     DRLLPTITFL GKRHGGASIG RGNEGGCGVL RHSAGTTTAH LLS                         703
//

If you have problems or comments...

PBIL Back to PBIL home page