(data stored in ACNUC7421 zone)

EMBL: CP002047.PE573

CP002047.PE573       Location/Qualifiers
FT   CDS             complement(727701..728189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00573"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03694"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0K3"
FT                   /protein_id="ADI03694.1"
FT                   /translation="MAKSIQLNKEWMEHFINVDVHDFQVELKNILKDRGDIPALGSLKK
FT                   ENPHDFADPPIPSGTQLPLTIGAMTGDGEELTNGAHLHKTLVALIDQIVGMIEEQQTLF
FT                   DDIEENLRETVHTLLKTQDGNLAKIDGEKFLDGLEDVEDDLTSGGSGSGGGDGENDEN"
     MAKSIQLNKE WMEHFINVDV HDFQVELKNI LKDRGDIPAL GSLKKENPHD FADPPIPSGT        60
     QLPLTIGAMT GDGEELTNGA HLHKTLVALI DQIVGMIEEQ QTLFDDIEEN LRETVHTLLK       120
     TQDGNLAKID GEKFLDGLED VEDDLTSGGS GSGGGDGEND EN                          162
//

If you have problems or comments...

PBIL Back to PBIL home page