(data stored in ACNUC7421 zone)

EMBL: CP002047.PE574

CP002047.PE574       Location/Qualifiers
FT   CDS             complement(728299..728616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00574"
FT                   /product="hypothetical protein"
FT                   /note="COG4842 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00574"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03695"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0K4"
FT                   /protein_id="ADI03695.1"
FT                   /translation="MDFSDGHIYVDFKGTDNAAEDMRLQTQNIDKILSQLESELQKFIS
FT                   SWEGEDRDVYVQKQKTWHEAVQEMKRLLASHAGLLNDIGDNYRTNQRNLTASWENVKIG
FT                   R"
     MDFSDGHIYV DFKGTDNAAE DMRLQTQNID KILSQLESEL QKFISSWEGE DRDVYVQKQK        60
     TWHEAVQEMK RLLASHAGLL NDIGDNYRTN QRNLTASWEN VKIGR                       105
//

If you have problems or comments...

PBIL Back to PBIL home page