(data stored in ACNUC7421 zone)

EMBL: CP002047.PE575

CP002047.PE575       Location/Qualifiers
FT   CDS             complement(728702..729037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00575"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03696"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0K5"
FT                   /protein_id="ADI03696.1"
FT                   /translation="MSELTRSEESATRNGISSTEEAFANIQVCRQDVENTKANVGGAYG
FT                   GSDGQKYQDLLQSWDDQAEIISKNLNDVIDTLNETLRANNLTQGSQKDAVDQEYAQSKA
FT                   IFDALHG"
     MSELTRSEES ATRNGISSTE EAFANIQVCR QDVENTKANV GGAYGGSDGQ KYQDLLQSWD        60
     DQAEIISKNL NDVIDTLNET LRANNLTQGS QKDAVDQEYA QSKAIFDALH G                111
//

If you have problems or comments...

PBIL Back to PBIL home page