(data stored in ACNUC7421 zone)

EMBL: CP002047.PE576

CP002047.PE576       Location/Qualifiers
FT   CDS             complement(729252..730703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00576"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03697"
FT                   /db_xref="GOA:D7C0K6"
FT                   /db_xref="InterPro:IPR007795"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0K6"
FT                   /protein_id="ADI03697.1"
FT                   /translation="MQTKRDQVQAHMFVMGRLTSAMLRADPDAPESPQGRTNRAVTISV
FT                   LIGILLCAGAFVFGLLSPGTKSSWRDPGTLVINKETGTRYLYLGGRLRPVRNHTSARLL
FT                   AGDQMKVMTIGSKSLRGTPHGSPVGISGAPDEPPGNDNLTGDPWQVCSGNTSGATGTTV
FT                   AVGANADGAGLKSGQGLLVSGPDKEDYLVWQGRRLRLDQKANAAEALGYGSTKPVPVSA
FT                   AFLNSLPAGPDLAPSAVPGRGGQGPELGGLKTRVGQVFKVAAPGGTARYYLLRKEGLAP
FT                   LTATGAALVLGDPDTRQKAYAGGAVSPASLGADALSGHLAPDTPEVETGKRQPETPPEP
FT                   VDLGAGRTPCVGVESGSDGTRVSVALIRDVNLGPTAQAPPEGLVPACVTVNRITVRPGG
FT                   GALVHVLGAGGGEVGNTLYLVTDTGMKYRLPAADSLKALGYSEGEAQAIPSSLLAMLPT
FT                   GPDLTPQAASMGRSKSSAPRCETNK"
     MQTKRDQVQA HMFVMGRLTS AMLRADPDAP ESPQGRTNRA VTISVLIGIL LCAGAFVFGL        60
     LSPGTKSSWR DPGTLVINKE TGTRYLYLGG RLRPVRNHTS ARLLAGDQMK VMTIGSKSLR       120
     GTPHGSPVGI SGAPDEPPGN DNLTGDPWQV CSGNTSGATG TTVAVGANAD GAGLKSGQGL       180
     LVSGPDKEDY LVWQGRRLRL DQKANAAEAL GYGSTKPVPV SAAFLNSLPA GPDLAPSAVP       240
     GRGGQGPELG GLKTRVGQVF KVAAPGGTAR YYLLRKEGLA PLTATGAALV LGDPDTRQKA       300
     YAGGAVSPAS LGADALSGHL APDTPEVETG KRQPETPPEP VDLGAGRTPC VGVESGSDGT       360
     RVSVALIRDV NLGPTAQAPP EGLVPACVTV NRITVRPGGG ALVHVLGAGG GEVGNTLYLV       420
     TDTGMKYRLP AADSLKALGY SEGEAQAIPS SLLAMLPTGP DLTPQAASMG RSKSSAPRCE       480
     TNK                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page