(data stored in ACNUC7421 zone)

EMBL: CP002047.PE577

CP002047.PE577       Location/Qualifiers
FT   CDS             complement(730736..732136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00577"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03698"
FT                   /db_xref="GOA:D7C0K7"
FT                   /db_xref="InterPro:IPR006707"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0K7"
FT                   /protein_id="ADI03698.1"
FT                   /translation="MTDTQVADLCRLTVRAPAKSVDLAVPSDVPVADLLPAVLGYGGED
FT                   LGEDGVDHGGWVLQRLGGGPMDEERTLDSYDLRDGETLYLRPRTEALPEAHLDDLVAGI
FT                   SDTMRSRPYGWTPEASRRLLLGLAVTVLTAGLVVLALPGGSVGVRAVCAAVTGLLLVAG
FT                   AGAASRAVGDAGAGATLGFMAAPYLAFAGWLLPGGDITGAHANEVVGSRLLASCVAGAG
FT                   GAIVVLAAVAAYAALFLGTGVVAVFGAITGTLMITADLAPHHVAGIIALAAVVLGAFVP
FT                   SLSFRMSGLKVPPLPTNAQQLQEGIEPHPTAAVAGRTALADGWMSSLYGAVGATCAACL
FT                   GALAWYANLPSVLTVVVLSLLLMLHARGLGNTWQRLSLTLPGVAGLLLLILVGAESYAP
FT                   DRRPLVAAGLLGLTAVIAIVSWTVPGRRLVPYWGRAAEILHYLMALSLLPLVLWALGVY
FT                   SALRGLMA"
     MTDTQVADLC RLTVRAPAKS VDLAVPSDVP VADLLPAVLG YGGEDLGEDG VDHGGWVLQR        60
     LGGGPMDEER TLDSYDLRDG ETLYLRPRTE ALPEAHLDDL VAGISDTMRS RPYGWTPEAS       120
     RRLLLGLAVT VLTAGLVVLA LPGGSVGVRA VCAAVTGLLL VAGAGAASRA VGDAGAGATL       180
     GFMAAPYLAF AGWLLPGGDI TGAHANEVVG SRLLASCVAG AGGAIVVLAA VAAYAALFLG       240
     TGVVAVFGAI TGTLMITADL APHHVAGIIA LAAVVLGAFV PSLSFRMSGL KVPPLPTNAQ       300
     QLQEGIEPHP TAAVAGRTAL ADGWMSSLYG AVGATCAACL GALAWYANLP SVLTVVVLSL       360
     LLMLHARGLG NTWQRLSLTL PGVAGLLLLI LVGAESYAPD RRPLVAAGLL GLTAVIAIVS       420
     WTVPGRRLVP YWGRAAEILH YLMALSLLPL VLWALGVYSA LRGLMA                      466
//

If you have problems or comments...

PBIL Back to PBIL home page