(data stored in ACNUC7421 zone)

EMBL: CP002047.PE579

CP002047.PE579       Location/Qualifiers
FT   CDS             complement(736602..736793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00579"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03700"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0K9"
FT                   /protein_id="ADI03700.1"
FT                   /translation="MTIPLTAGSASAAPQYRYFSTYKSAVDCQTAGNTLAQQGRITQFN
FT                   CNGKIVQGREKVWDLFVR"
     MTIPLTAGSA SAAPQYRYFS TYKSAVDCQT AGNTLAQQGR ITQFNCNGKI VQGREKVWDL        60
     FVR                                                                      63
//

If you have problems or comments...

PBIL Back to PBIL home page