(data stored in ACNUC7421 zone)

EMBL: CP002047.PE58

CP002047.PE58        Location/Qualifiers
FT   CDS             54632..55003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00058"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03179"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUI8"
FT                   /protein_id="ADI03179.1"
FT                   /translation="MSEAAADGHRPLIPQPKTTAEDLRAALVQIAPNQVAAFDAERTTA
FT                   VEAARSQVDAAPMRRFLRRWALAVAIERVPARAARLSELEARAGQVEDLAEGRAIAAEV
FT                   AAIHAQAAAEAGVDGRTAE"
     MSEAAADGHR PLIPQPKTTA EDLRAALVQI APNQVAAFDA ERTTAVEAAR SQVDAAPMRR        60
     FLRRWALAVA IERVPARAAR LSELEARAGQ VEDLAEGRAI AAEVAAIHAQ AAAEAGVDGR       120
     TAE                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page