(data stored in ACNUC7421 zone)

EMBL: CP002047.PE581

CP002047.PE581       Location/Qualifiers
FT   CDS             738653..741958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00581"
FT                   /product="hypothetical protein"
FT                   /note="COG0464 ATPases of the AAA+ class"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00581"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03702"
FT                   /db_xref="GOA:D7C0L1"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="InterPro:IPR041627"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0L1"
FT                   /protein_id="ADI03702.1"
FT                   /translation="MLTVGPDQTENFRTIGEALAKARTGAVIRVKPGRYRENLTVRTRL
FT                   TIVADGDRGSVEICPPRGTAVVLVADAVMLTDLMLRGGSEDLPVVDAPRGQVAMDGCTV
FT                   VGSGWTALLARENGSLAMRGCRVSNPEGAGIVDTAPTGSVIDDCLIEHLGTSAVVLSEQ
FT                   ARTTVRGCRMRDAKGNGLLANGEAQGRVEDCDISGTEKPAVALEGRCATHVARTHVHDT
FT                   SVGVYVTSAARPVLEEVTVSDTTGPGIVLAQGADPELLRCRTARTKGNGLAVTERSRGT
FT                   FQDCAFDAAASSAIRVVDSSAPLLSDTTVRDCADATAAVLLSEGASAEFDRLEVVDAAG
FT                   VAVSIRTGANPLLRNARLLAPGGHGVEVTEDGRGRLEDCTVERSAGAGIRAAGGGAPEI
FT                   TGTVLRSTAQAAVWVGTGGRATVRDCQIHAGTAAGLHVESGAELSAGRTQVTEAGAHGV
FT                   LVADGGRATLDACQISGSVGDGIRVDSSEQVTLTDCAVRDNRGAGLKQTRATERLTVRG
FT                   LNSSGNITPDAWGETAGDLAQEGKAAAGPGEKKPEGPLAELESLIGLADVKHQVRTLVN
FT                   VNQLAQRRASLGMPVPQMSRHLVFSGAPGTGKTTVARLYGGILAELGVLRSGHLVEVSR
FT                   ADLVAQIIGGTAIKTTEAFNEALGGVLFIDEAYTLLSDSRGSGADFGKEAIDTVLKLME
FT                   DHRDEVVVIAAGYTDEMSSFLASNPGLASRFTRTIEFANYSVEELVTITESMCAAHRYE
FT                   LAPSTLDALDRHYERMPRDATFGNGRAARQVFEEMIDRQAFRLGSMANPAEADLSLLLP
FT                   EDIADESAVAAGADGRSSEELLADLDAMIGLQAVKHEVTDLVNLLSATKRRQAAGLPTP
FT                   KISHHLVFSGPPGTGKTTVARLYAELLLSLGVLATGQLVEVARADLVGRYVGHTAQLTK
FT                   EVFERALGGVLFIDEAYTLTPEGAGSDFGREAVDTLLKLMEDHRDEVVVIVAGYTEEMA
FT                   RFLASNPGLASRFSRSVDFEHYSTDELVEIMSRHATASGYDCAPETVEALLQYVAGLPR
FT                   DRSFGNARTARQILEAMMTRQARRIGPMAAPGLEDLRLLLPEDLPVDTRQPAG"
     MLTVGPDQTE NFRTIGEALA KARTGAVIRV KPGRYRENLT VRTRLTIVAD GDRGSVEICP        60
     PRGTAVVLVA DAVMLTDLML RGGSEDLPVV DAPRGQVAMD GCTVVGSGWT ALLARENGSL       120
     AMRGCRVSNP EGAGIVDTAP TGSVIDDCLI EHLGTSAVVL SEQARTTVRG CRMRDAKGNG       180
     LLANGEAQGR VEDCDISGTE KPAVALEGRC ATHVARTHVH DTSVGVYVTS AARPVLEEVT       240
     VSDTTGPGIV LAQGADPELL RCRTARTKGN GLAVTERSRG TFQDCAFDAA ASSAIRVVDS       300
     SAPLLSDTTV RDCADATAAV LLSEGASAEF DRLEVVDAAG VAVSIRTGAN PLLRNARLLA       360
     PGGHGVEVTE DGRGRLEDCT VERSAGAGIR AAGGGAPEIT GTVLRSTAQA AVWVGTGGRA       420
     TVRDCQIHAG TAAGLHVESG AELSAGRTQV TEAGAHGVLV ADGGRATLDA CQISGSVGDG       480
     IRVDSSEQVT LTDCAVRDNR GAGLKQTRAT ERLTVRGLNS SGNITPDAWG ETAGDLAQEG       540
     KAAAGPGEKK PEGPLAELES LIGLADVKHQ VRTLVNVNQL AQRRASLGMP VPQMSRHLVF       600
     SGAPGTGKTT VARLYGGILA ELGVLRSGHL VEVSRADLVA QIIGGTAIKT TEAFNEALGG       660
     VLFIDEAYTL LSDSRGSGAD FGKEAIDTVL KLMEDHRDEV VVIAAGYTDE MSSFLASNPG       720
     LASRFTRTIE FANYSVEELV TITESMCAAH RYELAPSTLD ALDRHYERMP RDATFGNGRA       780
     ARQVFEEMID RQAFRLGSMA NPAEADLSLL LPEDIADESA VAAGADGRSS EELLADLDAM       840
     IGLQAVKHEV TDLVNLLSAT KRRQAAGLPT PKISHHLVFS GPPGTGKTTV ARLYAELLLS       900
     LGVLATGQLV EVARADLVGR YVGHTAQLTK EVFERALGGV LFIDEAYTLT PEGAGSDFGR       960
     EAVDTLLKLM EDHRDEVVVI VAGYTEEMAR FLASNPGLAS RFSRSVDFEH YSTDELVEIM      1020
     SRHATASGYD CAPETVEALL QYVAGLPRDR SFGNARTARQ ILEAMMTRQA RRIGPMAAPG      1080
     LEDLRLLLPE DLPVDTRQPA G                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page