(data stored in ACNUC7421 zone)

EMBL: CP002047.PE582

CP002047.PE582       Location/Qualifiers
FT   CDS             complement(742010..742684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00582"
FT                   /product="putative transcriptional regulator, TetR family
FT                   protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00582"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03703"
FT                   /db_xref="GOA:D7C0L2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041347"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0L2"
FT                   /protein_id="ADI03703.1"
FT                   /translation="MSAMATEKRPAGGMSERRRTRLRLEISREAARLFWKQGVAATSGD
FT                   QIADAVGLSTRTIWRHFRSKEACAEPIVMQGVVTLMSVLHSWPKDSSLEDHLAGELVRL
FT                   QYETRPVDLTDEMLAMKMIRLADTEPALRTAWLMACDQTEQQLRVIIGDRLGRPAGDLE
FT                   VRLHAAATAAVVRVLDEQIGVAFLADAGAGATELTEVKAAAGRFAHAIRAATGGAVGDP
FT                   IA"
     MSAMATEKRP AGGMSERRRT RLRLEISREA ARLFWKQGVA ATSGDQIADA VGLSTRTIWR        60
     HFRSKEACAE PIVMQGVVTL MSVLHSWPKD SSLEDHLAGE LVRLQYETRP VDLTDEMLAM       120
     KMIRLADTEP ALRTAWLMAC DQTEQQLRVI IGDRLGRPAG DLEVRLHAAA TAAVVRVLDE       180
     QIGVAFLADA GAGATELTEV KAAAGRFAHA IRAATGGAVG DPIA                        224
//

If you have problems or comments...

PBIL Back to PBIL home page