(data stored in ACNUC7421 zone)

EMBL: CP002047.PE583

CP002047.PE583       Location/Qualifiers
FT   CDS             complement(742767..743465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00583"
FT                   /product="hypothetical protein"
FT                   /note="COG0285 Folylpolyglutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00583"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03704"
FT                   /db_xref="InterPro:IPR025326"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0L3"
FT                   /protein_id="ADI03704.1"
FT                   /translation="MSSVRDTRIRLLTATAAVAIAALSLTACSDGSGEHDEGSSAGGSS
FT                   TGSFSGKDAKSSGAGSGQDGDAPAGKDFVAGGNGKTGTGDSRASGNKAVACKGSNTKTV
FT                   AAPVNKPVNHMLLTVINTGSAPCDLYGYPAARFGEAQSVPPVYEDSKPQAVVTLAPGEP
FT                   GYAAVNLSATDGSGTNGHTVKSLAVAFQDRTGEGTSWVAHPSLPAEGIYVDDSLCVTYW
FT                   QQSMDNALSW"
     MSSVRDTRIR LLTATAAVAI AALSLTACSD GSGEHDEGSS AGGSSTGSFS GKDAKSSGAG        60
     SGQDGDAPAG KDFVAGGNGK TGTGDSRASG NKAVACKGSN TKTVAAPVNK PVNHMLLTVI       120
     NTGSAPCDLY GYPAARFGEA QSVPPVYEDS KPQAVVTLAP GEPGYAAVNL SATDGSGTNG       180
     HTVKSLAVAF QDRTGEGTSW VAHPSLPAEG IYVDDSLCVT YWQQSMDNAL SW               232
//

If you have problems or comments...

PBIL Back to PBIL home page