(data stored in ACNUC7421 zone)

EMBL: CP002047.PE587

CP002047.PE587       Location/Qualifiers
FT   CDS             complement(748773..749597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00587"
FT                   /product="sugar transport integral membrane protein"
FT                   /note="COG0395 ABC-type sugar transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00587"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03708"
FT                   /db_xref="GOA:D7C0L7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0L7"
FT                   /protein_id="ADI03708.1"
FT                   /translation="MIAMPARTLRRGSNTVIALVVLAILLFPLYWMLNIALQPGESLAS
FT                   TSWFPTSPGWSNFERALDSQGGSLVTSLVVALGAVVVCLAMAAPAAYGLAQLGLRGGRS
FT                   IVFGTLITQMVPGIVIANALYSAYVDLHLVNSLPGLILADASLGLPFSIVLLRAFMVSI
FT                   PKEIVEAAMVDGANRFTAFVRIVLPISRNSLITAGLFTFLFAWSDFMFALTLNTTDDVK
FT                   PITLSMYEYIGAHVSDWGAVMATAVVSAVPAAILLILAQKYVAAGITGGSVK"
     MIAMPARTLR RGSNTVIALV VLAILLFPLY WMLNIALQPG ESLASTSWFP TSPGWSNFER        60
     ALDSQGGSLV TSLVVALGAV VVCLAMAAPA AYGLAQLGLR GGRSIVFGTL ITQMVPGIVI       120
     ANALYSAYVD LHLVNSLPGL ILADASLGLP FSIVLLRAFM VSIPKEIVEA AMVDGANRFT       180
     AFVRIVLPIS RNSLITAGLF TFLFAWSDFM FALTLNTTDD VKPITLSMYE YIGAHVSDWG       240
     AVMATAVVSA VPAAILLILA QKYVAAGITG GSVK                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page