(data stored in ACNUC7421 zone)

EMBL: CP002047.PE588

CP002047.PE588       Location/Qualifiers
FT   CDS             complement(749594..750547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00588"
FT                   /product="sugar transport integral membrane protein"
FT                   /note="COG1175 ABC-type sugar transport systems, permease
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00588"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03709"
FT                   /db_xref="GOA:D7C0L8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0L8"
FT                   /protein_id="ADI03709.1"
FT                   /translation="MSTTTAVPAKSVAASPAVPGRRASRAALTRWLFVAPAVLYMLAFF
FT                   GYPLVRNVVMSFQHYTPRTFFTGEAPFNGLDNWTAVFGNELFTESLWHTAVFTLGSLLG
FT                   QFVLGLALAVFFSRRFRLSGFARAVLLLPWLIPMVVSSVVWRKLLDQDTGVLNTLLMNL
FT                   HLTSEPVPWLSSPSVALLSAILVNIWVGIPFNMVILYGGLQEIPREMYEAASLDGAGPW
FT                   RTFRSITLPQLRPVITVVLVLGFMSTIKILDLILALTGGGPADSTQTLGTATYQLSFQQ
FT                   LDFGQGAVVGNVLILISAVFAVFYLRANRSDFGQGK"
     MSTTTAVPAK SVAASPAVPG RRASRAALTR WLFVAPAVLY MLAFFGYPLV RNVVMSFQHY        60
     TPRTFFTGEA PFNGLDNWTA VFGNELFTES LWHTAVFTLG SLLGQFVLGL ALAVFFSRRF       120
     RLSGFARAVL LLPWLIPMVV SSVVWRKLLD QDTGVLNTLL MNLHLTSEPV PWLSSPSVAL       180
     LSAILVNIWV GIPFNMVILY GGLQEIPREM YEAASLDGAG PWRTFRSITL PQLRPVITVV       240
     LVLGFMSTIK ILDLILALTG GGPADSTQTL GTATYQLSFQ QLDFGQGAVV GNVLILISAV       300
     FAVFYLRANR SDFGQGK                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page