(data stored in ACNUC7421 zone)

EMBL: CP002047.PE589

CP002047.PE589       Location/Qualifiers
FT   CDS             complement(750557..751789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00589"
FT                   /product="sugar transport sugar binding protein"
FT                   /note="COG1653 ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00589"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03710"
FT                   /db_xref="GOA:D7C0L9"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0L9"
FT                   /protein_id="ADI03710.1"
FT                   /translation="MPLLRRRPPAPVLLLTLLVASAGLTGCAREADPNTITVLNSATDK
FT                   HEHDQQQKFFDRCAEPLGVKVEQTSVPAAQVATKALRMASSHSMTDILELDGSELPQFA
FT                   DTGGLVPLKTAGVAVDGLSPGAVSMGSFKGTAYGIARSVNTLALFYNTDVLKEAGVTPP
FT                   ATWDELKVAAKKLTRGKMFGMAFSATPDADGVYQFLPFFWSAGGDEARIDNGKGEQAVQ
FT                   LWKDLVTDRSASSAVVTWNQQDVNDQFIAGRTAMMVNGPWQVPVLSQHKSLHWAVTTIP
FT                   VPVAGKAPVAPMGGTVMTLPRTGDTGRQATAAKILNCLNERRNQVGWGAGVNNIPTRAS
FT                   AAAEYKADNPKLAGFADTVATARSRTAKVGARWPAVSSALAGAFQSVLTGSSSPEAALK
FT                   RAQSQATAGGE"
     MPLLRRRPPA PVLLLTLLVA SAGLTGCARE ADPNTITVLN SATDKHEHDQ QQKFFDRCAE        60
     PLGVKVEQTS VPAAQVATKA LRMASSHSMT DILELDGSEL PQFADTGGLV PLKTAGVAVD       120
     GLSPGAVSMG SFKGTAYGIA RSVNTLALFY NTDVLKEAGV TPPATWDELK VAAKKLTRGK       180
     MFGMAFSATP DADGVYQFLP FFWSAGGDEA RIDNGKGEQA VQLWKDLVTD RSASSAVVTW       240
     NQQDVNDQFI AGRTAMMVNG PWQVPVLSQH KSLHWAVTTI PVPVAGKAPV APMGGTVMTL       300
     PRTGDTGRQA TAAKILNCLN ERRNQVGWGA GVNNIPTRAS AAAEYKADNP KLAGFADTVA       360
     TARSRTAKVG ARWPAVSSAL AGAFQSVLTG SSSPEAALKR AQSQATAGGE                  410
//

If you have problems or comments...

PBIL Back to PBIL home page