(data stored in ACNUC7421 zone)

EMBL: CP002047.PE59

CP002047.PE59        Location/Qualifiers
FT   CDS             55000..55296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00059"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03180"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUI9"
FT                   /protein_id="ADI03180.1"
FT                   /translation="MTEDAGQGWRWEYEPDYEYVAKGLPKRVVVEVERLAGQLVDLAEM
FT                   GIDVTAVGDGPRPGVAGGVRRLSVLEDGFMLVLPLPRLRLVAVTYICPPFADL"
     MTEDAGQGWR WEYEPDYEYV AKGLPKRVVV EVERLAGQLV DLAEMGIDVT AVGDGPRPGV        60
     AGGVRRLSVL EDGFMLVLPL PRLRLVAVTY ICPPFADL                                98
//

If you have problems or comments...

PBIL Back to PBIL home page