(data stored in ACNUC7421 zone)

EMBL: CP002047.PE591

CP002047.PE591       Location/Qualifiers
FT   CDS             complement(753234..754829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00591"
FT                   /product="transcriptional regulator, PucR family protein"
FT                   /note="COG2508 Regulator of polyketide synthase expression"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00591"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03712"
FT                   /db_xref="InterPro:IPR012914"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:D7C258"
FT                   /protein_id="ADI03712.1"
FT                   /translation="MQLTIREVLALPVMAAGRPRVIGGRDHLDRPVRWVHISDLTDLTD
FT                   LLEGGELVLTTGLPLSGGAREASAYLTMLAEQDVAGLVIELGTHLKAVPDYLGTLADSV
FT                   RLPVVVLSATIRFIEVTQQVHRLIVADQYDEVEFARTTHEVFTSLNIARASTTDIVTRA
FT                   AQTLGAPLVLEDLGRHVLAFCAVDTPTAQLLYQWAERSRLHASADTPTGSAWSAVSVGV
FT                   GSERWGRLVLPARTPNASRARMVLERAAQSLQLHRMIQQERDALVVHAHGGLLDDLRGG
FT                   RINDGAEALARASALGLTPSTHYVPLSVRVPGRPDTDALTQGEVDRRLLTAVRQAVAAA
FT                   GQSAIVAIRREGTVSAIMSCSPKGADSALSAVCRGLRERLTGRGGTDGWAAGTAPASPS
FT                   LIAAAQGITEAEHVADVGLTMPETNRLYRSTDVRLRGLVALLRNDHRVQAFAETELGRL
FT                   LDHDARTGDNLLTLLRTHLDCAGSKTHTARLTGLSRPTLYSRLRTIERILDVSLESAES
FT                   RTSLHTALMIVDAR"
     MQLTIREVLA LPVMAAGRPR VIGGRDHLDR PVRWVHISDL TDLTDLLEGG ELVLTTGLPL        60
     SGGAREASAY LTMLAEQDVA GLVIELGTHL KAVPDYLGTL ADSVRLPVVV LSATIRFIEV       120
     TQQVHRLIVA DQYDEVEFAR TTHEVFTSLN IARASTTDIV TRAAQTLGAP LVLEDLGRHV       180
     LAFCAVDTPT AQLLYQWAER SRLHASADTP TGSAWSAVSV GVGSERWGRL VLPARTPNAS       240
     RARMVLERAA QSLQLHRMIQ QERDALVVHA HGGLLDDLRG GRINDGAEAL ARASALGLTP       300
     STHYVPLSVR VPGRPDTDAL TQGEVDRRLL TAVRQAVAAA GQSAIVAIRR EGTVSAIMSC       360
     SPKGADSALS AVCRGLRERL TGRGGTDGWA AGTAPASPSL IAAAQGITEA EHVADVGLTM       420
     PETNRLYRST DVRLRGLVAL LRNDHRVQAF AETELGRLLD HDARTGDNLL TLLRTHLDCA       480
     GSKTHTARLT GLSRPTLYSR LRTIERILDV SLESAESRTS LHTALMIVDA R                531
//

If you have problems or comments...

PBIL Back to PBIL home page