(data stored in ACNUC7421 zone)

EMBL: CP002047.PE593

CP002047.PE593       Location/Qualifiers
FT   CDS             756485..757849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00593"
FT                   /product="hypothetical protein"
FT                   /note="COG0160 4-aminobutyrate aminotransferase and related
FT                   aminotransferases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00593"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03714"
FT                   /db_xref="GOA:D7C260"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7C260"
FT                   /protein_id="ADI03714.1"
FT                   /translation="MTLVHPELNPQAIARTYELDRRHVFHSWSAQAEITPMVITRAEGS
FT                   YIWDGEGNRLLDFSSQLVNTNIGHQHPYVVEAIADQARTLATVAPQHANDQRSEAARLI
FT                   CERAPGELNRVFFTNGGADANEHAVRMARLTTGRPKVLSRYRSYHGGTQTAINLTGDPR
FT                   RWPNDEGTSGVVHFFGPYLYRSHFDATTEEEECRRALAHLEQVIELEGPQTIAAILLEA
FT                   IPGTAGIMPPPPGYLAGVRALCDQYGIVFIVDEVMTGFGRTGAWFVCDDEGVVPDLLTF
FT                   AKGVNSGYVPLGGVVISDRIAEHFAHRPYPGGLTYSGHPLACAAAVAAITVMERDGIID
FT                   NARRIGTDVFGPELVRLAAQHPSVGEVRGRGVFWAIELVTDRHTRRPVAPTGGSSPVMA
FT                   EAVRASKELGLLPFTNSGRIHLVPPCTITESEAREGLHIIDQVLSRVDTLCGASS"
     MTLVHPELNP QAIARTYELD RRHVFHSWSA QAEITPMVIT RAEGSYIWDG EGNRLLDFSS        60
     QLVNTNIGHQ HPYVVEAIAD QARTLATVAP QHANDQRSEA ARLICERAPG ELNRVFFTNG       120
     GADANEHAVR MARLTTGRPK VLSRYRSYHG GTQTAINLTG DPRRWPNDEG TSGVVHFFGP       180
     YLYRSHFDAT TEEEECRRAL AHLEQVIELE GPQTIAAILL EAIPGTAGIM PPPPGYLAGV       240
     RALCDQYGIV FIVDEVMTGF GRTGAWFVCD DEGVVPDLLT FAKGVNSGYV PLGGVVISDR       300
     IAEHFAHRPY PGGLTYSGHP LACAAAVAAI TVMERDGIID NARRIGTDVF GPELVRLAAQ       360
     HPSVGEVRGR GVFWAIELVT DRHTRRPVAP TGGSSPVMAE AVRASKELGL LPFTNSGRIH       420
     LVPPCTITES EAREGLHIID QVLSRVDTLC GASS                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page