(data stored in ACNUC7421 zone)

EMBL: CP002047.PE594

CP002047.PE594       Location/Qualifiers
FT   CDS             complement(757844..758059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00594"
FT                   /product="hypothetical protein"
FT                   /note="COG0440 Acetolactate synthase, small (regulatory)
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00594"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03715"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:D7C261"
FT                   /protein_id="ADI03715.1"
FT                   /translation="MLQLEVVAMPLAVARVASILAHRQFDLITMDVAAPVDGLRRITIE
FT                   VDTADEIKLQQLVKFLNRAPEVVTVS"
     MLQLEVVAMP LAVARVASIL AHRQFDLITM DVAAPVDGLR RITIEVDTAD EIKLQQLVKF        60
     LNRAPEVVTV S                                                             71
//

If you have problems or comments...

PBIL Back to PBIL home page