(data stored in ACNUC7421 zone)

EMBL: CP002047.PE596

CP002047.PE596       Location/Qualifiers
FT   CDS             758954..759793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00596"
FT                   /product="Non-specific serine/threonine protein kinase"
FT                   /note="COG1262 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00596"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03717"
FT                   /db_xref="GOA:D7C263"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:D7C263"
FT                   /protein_id="ADI03717.1"
FT                   /translation="MGGDDADAFPEDGEGPVRAVRLSPFLIDATAVTNRQFAAFVRASG
FT                   YRTDAERYGWSYVFYALVHPGARHLVRDTVAQAPWWLAVEGACWQAPYGPGSSWTELSN
FT                   HPVVHVSWRDASAYAAWAGKRLPTEAEWERAARGGLERSRFPWGDELLPRGQHRCNIWQ
FT                   GRFPQVNTGEDGYLGTAPVKTFRPNNFGLYNTSGNVWEWCSDWWSTTWHAADRPETRQD
FT                   PAGPPAGEAKVIRGGSYLCHASYCNRYRVAARTSNTPDSSTGHMGFRCAADLPRTVR"
     MGGDDADAFP EDGEGPVRAV RLSPFLIDAT AVTNRQFAAF VRASGYRTDA ERYGWSYVFY        60
     ALVHPGARHL VRDTVAQAPW WLAVEGACWQ APYGPGSSWT ELSNHPVVHV SWRDASAYAA       120
     WAGKRLPTEA EWERAARGGL ERSRFPWGDE LLPRGQHRCN IWQGRFPQVN TGEDGYLGTA       180
     PVKTFRPNNF GLYNTSGNVW EWCSDWWSTT WHAADRPETR QDPAGPPAGE AKVIRGGSYL       240
     CHASYCNRYR VAARTSNTPD SSTGHMGFRC AADLPRTVR                              279
//

If you have problems or comments...

PBIL Back to PBIL home page