(data stored in ACNUC7421 zone)

EMBL: CP002047.PE6

CP002047.PE6         Location/Qualifiers
FT   CDS             complement(7227..7409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00006"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03127"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSV0"
FT                   /protein_id="ADI03127.1"
FT                   /translation="MIDGRYDDFANHCWYVTRWLTEPRETTHLDAAPLSRWRRVVDGLV
FT                   AAGDRSAVELQRIDE"
     MIDGRYDDFA NHCWYVTRWL TEPRETTHLD AAPLSRWRRV VDGLVAAGDR SAVELQRIDE        60
//

If you have problems or comments...

PBIL Back to PBIL home page