(data stored in ACNUC7421 zone)

EMBL: CP002047.PE60

CP002047.PE60        Location/Qualifiers
FT   CDS             complement(55878..57026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00060"
FT                   /product="Beta-lactamase class C and other penicillin
FT                   binding protein-like protein"
FT                   /note="COG1680 Beta-lactamase class C and other penicillin
FT                   binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00060"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03181"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUJ0"
FT                   /protein_id="ADI03181.1"
FT                   /translation="MHVLGRRRRGPLVLTGLAAVLLAASTGLTAAAKPQQADPLQQQVD
FT                   AIHDTGAVGVLAEVTSPDTRDSARAGTAELGTGRPMPRNGRFRIGSAAKTFTATVVLQL
FT                   VGEGRMSLEDTVEQWLPGVVRGNDNDGSQITVRQLLQHTSGIRDVLPEIPALNSADGYR
FT                   AERFRTYTPEELVRLAIQHRPNFPPGDGWSYSNTNYILAAMIIHEVTGRSWAQEVNDRI
FT                   IRPLGLRDTSMPGAFPSILGPHAHSYAAFGTHTRTDVTVLNSSMAVGSGSIISTTHDLN
FT                   RFYTALLGGRLLAPAQLDEMTTTKPAPELGVRYGLGLGEIPLSCGGSYFGHPGELLGYR
FT                   TWGGVTRDGTRTAVVYVTSDGGRNTQQAMSTLVDQELCRTRS"
     MHVLGRRRRG PLVLTGLAAV LLAASTGLTA AAKPQQADPL QQQVDAIHDT GAVGVLAEVT        60
     SPDTRDSARA GTAELGTGRP MPRNGRFRIG SAAKTFTATV VLQLVGEGRM SLEDTVEQWL       120
     PGVVRGNDND GSQITVRQLL QHTSGIRDVL PEIPALNSAD GYRAERFRTY TPEELVRLAI       180
     QHRPNFPPGD GWSYSNTNYI LAAMIIHEVT GRSWAQEVND RIIRPLGLRD TSMPGAFPSI       240
     LGPHAHSYAA FGTHTRTDVT VLNSSMAVGS GSIISTTHDL NRFYTALLGG RLLAPAQLDE       300
     MTTTKPAPEL GVRYGLGLGE IPLSCGGSYF GHPGELLGYR TWGGVTRDGT RTAVVYVTSD       360
     GGRNTQQAMS TLVDQELCRT RS                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page