(data stored in ACNUC7421 zone)

EMBL: CP002047.PE600

CP002047.PE600       Location/Qualifiers
FT   CDS             complement(764587..765420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00600"
FT                   /product="ABC transporter related protein"
FT                   /note="COG1123 ATPase components of various ABC-type
FT                   transport systems, contain duplicated ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00600"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03721"
FT                   /db_xref="GOA:D7C267"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7C267"
FT                   /protein_id="ADI03721.1"
FT                   /translation="MAEQPTAISVRDVTRVYHRPRTSLRHPSPPVHALRGVSFTVPQGQ
FT                   RFGIVGESGCGKSTLLRILAGLDRPTSGSVAIDGRDITGLRERQLGFVRERLQLVFQDP
FT                   MSSLDPRMRVGDIVAEPLVAQGHSNRRERVAELLEAVGLRADAADRYPHQFSGGQRQRI
FT                   SIARALAPRPKIIVADEPVSALDVSVRAQVLNLIADLVEELSLTLVFVSHDLSVVRHVC
FT                   DRVAVMNGGQIVETGPTEQVYEEPQHSYTRRLIAAVPTLGKALSGVSAADLNREY"
     MAEQPTAISV RDVTRVYHRP RTSLRHPSPP VHALRGVSFT VPQGQRFGIV GESGCGKSTL        60
     LRILAGLDRP TSGSVAIDGR DITGLRERQL GFVRERLQLV FQDPMSSLDP RMRVGDIVAE       120
     PLVAQGHSNR RERVAELLEA VGLRADAADR YPHQFSGGQR QRISIARALA PRPKIIVADE       180
     PVSALDVSVR AQVLNLIADL VEELSLTLVF VSHDLSVVRH VCDRVAVMNG GQIVETGPTE       240
     QVYEEPQHSY TRRLIAAVPT LGKALSGVSA ADLNREY                                277
//

If you have problems or comments...

PBIL Back to PBIL home page