(data stored in ACNUC7421 zone)

EMBL: CP002047.PE601

CP002047.PE601       Location/Qualifiers
FT   CDS             complement(765413..766456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00601"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="COG0444 ABC-type dipeptide/oligopeptide/nickel
FT                   transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00601"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03722"
FT                   /db_xref="GOA:D7C268"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7C268"
FT                   /protein_id="ADI03722.1"
FT                   /translation="MTGNVTGDVLAVRNLDVTVGGRKLVEDVGFTIGAGERVGLIGESG
FT                   SGKSLTALSVMGLLPEGLRATGSVRLAGVDHDLVGADEARMSRVRGKEIAMVFQEPMTA
FT                   LNPTMRVGRQIAEVLLIHRTRPDRASARAAAVELLAQVGLPDPAAAAQAYPHQFSGGQR
FT                   QRVVLAIALANDPALLVCDEPTTALDVTVQARVLDLIVRGVQDRRSAMLFITHDLAVVA
FT                   TACERVMVMYGGRLVESGPVQEVFTRPRHRYTQGLIGASDLTVVDDRGRLATIPGSVPP
FT                   AGQFPAGCVFRNRCAHATEACATRPEWVPTGPDSGYACFHPASESPASQSGAHVKGTPM
FT                   NQEAGRG"
     MTGNVTGDVL AVRNLDVTVG GRKLVEDVGF TIGAGERVGL IGESGSGKSL TALSVMGLLP        60
     EGLRATGSVR LAGVDHDLVG ADEARMSRVR GKEIAMVFQE PMTALNPTMR VGRQIAEVLL       120
     IHRTRPDRAS ARAAAVELLA QVGLPDPAAA AQAYPHQFSG GQRQRVVLAI ALANDPALLV       180
     CDEPTTALDV TVQARVLDLI VRGVQDRRSA MLFITHDLAV VATACERVMV MYGGRLVESG       240
     PVQEVFTRPR HRYTQGLIGA SDLTVVDDRG RLATIPGSVP PAGQFPAGCV FRNRCAHATE       300
     ACATRPEWVP TGPDSGYACF HPASESPASQ SGAHVKGTPM NQEAGRG                     347
//

If you have problems or comments...

PBIL Back to PBIL home page