(data stored in ACNUC7421 zone)

EMBL: CP002047.PE603

CP002047.PE603       Location/Qualifiers
FT   CDS             complement(767343..768293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00603"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COG0601 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00603"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03724"
FT                   /db_xref="GOA:D7C270"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7C270"
FT                   /protein_id="ADI03724.1"
FT                   /translation="MIVRLVQRIGILLASLVVSSVLVFAFMAVLPGDPARVALGVSASD
FT                   TAVAQLREQFGLDRPLVVQYFSWVKGLVTFDPGNSYISQTAIGPQIADRLQVTLWLVGA
FT                   GMALACILAIPMGTLMAVRHRKPSGLILSALSQVGVAVPAFLAGILLVTVFAVGLGWLP
FT                   ANGWTPPAQDPVMFLKQLVLPALSLGLVQGAMLTRYVRSAVLDVLREDYLRTARAKGLR
FT                   PTRALLRHGLRNAAVPVVTVLALHLATLLVGAVVIERVFVIPGLGSLLLDSVSNRDLIM
FT                   VQDVVMIIAMAVLLVNFLVDIIYLVIDPRLRAGAS"
     MIVRLVQRIG ILLASLVVSS VLVFAFMAVL PGDPARVALG VSASDTAVAQ LREQFGLDRP        60
     LVVQYFSWVK GLVTFDPGNS YISQTAIGPQ IADRLQVTLW LVGAGMALAC ILAIPMGTLM       120
     AVRHRKPSGL ILSALSQVGV AVPAFLAGIL LVTVFAVGLG WLPANGWTPP AQDPVMFLKQ       180
     LVLPALSLGL VQGAMLTRYV RSAVLDVLRE DYLRTARAKG LRPTRALLRH GLRNAAVPVV       240
     TVLALHLATL LVGAVVIERV FVIPGLGSLL LDSVSNRDLI MVQDVVMIIA MAVLLVNFLV       300
     DIIYLVIDPR LRAGAS                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page